CXCL6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16207
Additional Names:: CKA-3|CXCL6|GCP-2|GCP2|SCYB6
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Uniprot:: P80162
Synonyms:: C-X-C motif chemokine 6;chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2);chemokine alpha 3;CKA-3;GCP-2;GCP2;granulocyte chemotactic protein 2;SCYB6;small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2);small inducible cytokine subfamily B (Cys-X-Cys), member b;small-inducible cytokine B6
Extra Details:: The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.