SLC6A9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16203
Additional Names:: GCENSG|GLYT1|SLC6A9
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV
Uniprot:: P48067
Synonyms:: GCENSG;glyT-1;GLYT1;sodium- and chloride-dependent glycine transporter 1;solute carrier family 6 (neurotransmitter transporter, glycine), member 9;Solute carrier family 6 member 9
Extra Details:: The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.