A16192
MAGOHB Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16192
- Additional Names:
- mago|magoh|MAGOHB|MGN2
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
- Uniprot:
- Q96A72
- Synonyms:
- mago;mago homolog B, exon junction complex core component;mago-nashi homolog B;magoh;MGN2;protein mago nashi homolog 2
- Extra Details:
- Enables RNA binding activity. Involved in mRNA splicing, via spliceosome and nuclear-transcribed mRNA catabolic process, nonsense-mediated decay. Located in nucleus. Part of U2-type catalytic step 1 spliceosome; U2-type precatalytic spliceosome; and exon-exon junction complex.
- Shipping Conditions:
- Blue Ice