WBP11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16191
Additional Names:: BUG13|CFAP90|FAP90|NPWBP|PPP1R165|SIPP1|VCTERL|VCTRL|WBP-11|WBP11
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 115kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL
Uniprot:: Q9Y2W2
Synonyms:: BUG13;CFAP90;FAP90;Npw38-binding protein;Npw38-binding protein NpwBP;NPWBP;PPP1R165;protein phosphatase 1, regulatory subunit 165;SH3 domain-binding protein SNP70;SIPP1;splicing factor that interacts with PQBP-1 and PP1;splicing factor, PQBP1 and PP1 interacting;VCTERL;VCTRL;WBP-11;WW domain-binding protein 11
Extra Details:: This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.