SERPINA9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16182
Additional Names:: GCET1|SERPINA11|SERPINA11b|SERPINA9
Application:: ELISA, WB
Molecular Weight:: 46kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Uniprot:: Q86WD7
Synonyms:: centerin;GCET1;germinal center B-cell-expressed transcript 1 protein;serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9;serine proteinase inhibitor A11;serpin A9;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9;SERPINA11;SERPINA11b
Extra Details:: Enables serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to be located in cytoplasm and membrane. Predicted to be active in extracellular space.