GPR155 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16173
Additional Names:: DEP.7|DEPDC3|GPR155|PGR22
Application:: ELISA, WB
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT
Uniprot:: Q7Z3F1
Synonyms:: DEP.7;DEPDC3;G-protein coupled receptor PGR22;integral membrane protein GPR155;PGR22
Extra Details:: Involved in cognition. Located in extracellular exosome.