S100A16 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16167
Additional Names:: AAG13|DT1P1A7|S100A16|S100F
Application:: ELISA, WB
Molecular Weight:: 12kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
Uniprot:: Q96FQ6
Synonyms:: AAG13;aging-associated gene 13 protein;aging-associated protein 13;DT1P1A7;protein S100-A16;protein S100-F;S100 calcium-binding protein A16;S100F
Extra Details:: Enables calcium ion binding activity and protein homodimerization activity. Predicted to act upstream of or within response to calcium ion. Located in several cellular components, including cytosol; extracellular space; and nucleolus.