A16149
PVRL4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16149
- Additional Names:
- EDSS1|LNIR|nectin-4|PRR4|PVRL4
- Application:
- ELISA, WB
- Molecular Weight:
- 62kDa/75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVL
- Uniprot:
- Q96NY8
- Synonyms:
- EDSS1;Ig superfamily receptor LNIR;LNIR;nectin 4;Nectin cell adhesion molecule 4;nectin-4;poliovirus receptor-related 4;poliovirus receptor-related protein 4;PRR4;PVRL4
- Extra Details:
- This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.
- Shipping Conditions:
- Blue Ice

