BPIFB2 Rabbit polyclonal antibody

Size

POA

SKU:: A16148
Additional Names:: BPIFB2|BPIL1|C20orf184|dJ726C3.2|LPLUNC2|RYSR
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEPMPVVLKVRLGATPVAMLHTNNATLRLQPF
Uniprot:: Q8N4F0
Synonyms:: bactericidal/permeability-increasing protein-like 1;BPI fold-containing family B member 2;BPI-like 1;BPIL1;C20orf184;dJ726C3.2;long palate, lung and nasal epithelium carcinoma-associated protein 2;LPLUNC2;RYSR
Extra Details:: This gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromosome 20.