A16147
CEP290 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16147
- Additional Names:
- 3H11Ag|BBS14|CEP290|CT87|JBTS5|LCA10|MKS4|NPHP6|POC3|rd16|SLSN6
- Application:
- ELISA, WB
- Molecular Weight:
- 290kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNS
- Uniprot:
- O15078
- Synonyms:
- 3H11Ag;Bardet-Biedl syndrome 14 protein;BBS14;cancer/testis antigen 87;centrosomal protein 290kDa;centrosomal protein of 290 kDa;CT87;CTCL tumor antigen se2-2;JBTS5;LCA10;Meckel syndrome, type 4;MKS4;monoclonal antibody 3H11 antigen;Nephrocystin-6;nephrocytsin-6;NPHP6;POC3;POC3 centriolar protein homolog;prostate cancer antigen T21;rd16;SLSN6;tumor antigen se2-2
- Extra Details:
- This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer.
- Shipping Conditions:
- Blue Ice