TRPV6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16128
Additional Names:: ABP/ZF|CAT1|CATL|ECAC2|HRPTTN|HSA277909|LP6728|TRPV6|ZFAB
Application:: ELISA, WB, IHC-P
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFCRWFQRRESWAQSRDEQNLLQQKRIWESPLLLAAKDNDVQA
Uniprot:: Q9H1D0
Synonyms:: ABP/ZF;Alu-binding protein with zinc finger domain;calcium transport protein 1;calcium transporter-like protein;CaT-like;CAT1;CATL;ECAC2;epithelial apical membrane calcium transporter/channel CaT1;epithelial calcium channel 2;HRPTTN;HSA277909;LP6728;transient receptor potential cation channel subfamily V member 6;ZFAB
Extra Details:: This gene encodes a member of a family of multipass membrane proteins that functions as calcium channels. The encoded protein contains N-terminal ankyrin repeats, which are required for channel assembly and regulation. Translation initiation for this protein occurs at a non-AUG start codon that is decoded as methionine. This gene is situated next to a closely related gene for transient receptor potential cation channel subfamily V member 5 (TRPV5). This locus has experienced positive selection in non-African populations, resulting in several non-synonymous codon differences among individuals of different genetic backgrounds.

Shipping Conditions:: Blue Ice