EML4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16117
Additional Names:: C2orf2|ELP120|EMAP-4|EMAPL4|EML4|ROPP120
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 120kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE
Uniprot:: Q9HC35
Synonyms:: C2orf2;echinoderm microtubule associated protein like 4;echinoderm microtubule-associated protein-like 4;ELP120;EMAP-4;EMAPL4;restrictedly overexpressed proliferation-associated protein;ropp 120;ROPP120
Extra Details:: This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants.