A16111
COG4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16111
- Additional Names:
- CDG2J|COD1|COG4|SWILS
- Application:
- ELISA, WB
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN
- Uniprot:
- Q9H9E3
- Synonyms:
- CDG2J;COD1;COG complex subunit 4;complexed with Dor1p;Component of oligomeric Golgi complex 4;conserved oligomeric Golgi complex protein 4;conserved oligomeric Golgi complex subunit 4;SWILS
- Extra Details:
- The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice