CDK19 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16109
Additional Names:: bA346C16.3|CDC2L6|CDK11|CDK19|DEE87|EIEE87
Application:: ELISA, WB, IHC-P
Molecular Weight:: 57kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
Uniprot:: Q9BWU1
Synonyms:: bA346C16.3;CDC2-related protein kinase 6;CDC2L6;CDK11;CDK8-like cyclin-dependent kinase;cell division cycle 2-like 6 (CDK8-like);cell division cycle 2-like protein kinase 6;cell division protein kinase 19;cyclin dependent kinase 19 variant 2;cyclin-dependent kinase (CDC2-like) 11;cyclin-dependent kinase 11;cyclin-dependent kinase 19;death-preventing kinase;DEE87;EIEE87
Extra Details:: This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.