TAP2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1610
Additional Names:: ABC18|ABCB3|APT2|D6S217E|PSF-2|PSF2|RING11|TAP2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 75 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Uniprot:: Q03519
Synonyms:: ABC transporter, MHC 2;ABC18;ABCB3;antigen peptide transporter 2;APT2;ATP-binding cassette sub-family B member 3;ATP-binding cassette, sub-family B (MDR/TAP), member 3;D6S217E;peptide supply factor 2;peptide transporter involved in antigen processing 2;peptide transporter PSF2;Peptide transporter TAP2;PSF-2;PSF2;really interesting new gene 11 protein;RING11;transporter 2, ABC (ATP binding cassette);transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Extra Details:: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.

Shipping Conditions:: Blue Ice