A1610
TAP2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1610
- Additional Names:
- ABC18|ABCB3|APT2|D6S217E|PSF-2|PSF2|RING11|TAP2
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 75 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
- Uniprot:
- Q03519
- Synonyms:
- ABC transporter, MHC 2;ABC18;ABCB3;antigen peptide transporter 2;APT2;ATP-binding cassette sub-family B member 3;ATP-binding cassette, sub-family B (MDR/TAP), member 3;D6S217E;peptide supply factor 2;peptide transporter involved in antigen processing 2;peptide transporter PSF2;Peptide transporter TAP2;PSF-2;PSF2;really interesting new gene 11 protein;RING11;transporter 2, ABC (ATP binding cassette);transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
- Extra Details:
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.
- Shipping Conditions:
- Blue Ice




_WB_01.jpg)


