A16092
ABI1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16092
- Additional Names:
- ABI-1|ABI1|ABLBP4|E3B1|NAP1BP|SSH3BP|SSH3BP1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 55-65kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQR
- Uniprot:
- Q8IZP0
- Synonyms:
- Abelson interactor 1;ABI-1;abl interactor 1;abl-binding protein 4;Abl-interactor protein 1 long;ABLBP4;E3B1;eps8 SH3 domain-binding protein;interactor protein AblBP4;nap1 binding protein;Nap1-binding protein;NAP1BP;spectrin SH3 domain-binding protein 1;SSH3BP;SSH3BP1
- Extra Details:
- This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14.
- Shipping Conditions:
- Blue Ice








