SLC28A2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16086
Additional Names:: CNT2|HCNT2|HsT17153|SLC28A2|SPNT1
Application:: ELISA, WB
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI
Uniprot:: O43868
Synonyms:: CNT 2;CNT2;concentrative nucleoside transporter 2;HCNT2;HsT17153;Na(+)/nucleoside cotransporter 2;sodium-coupled nucleoside transporter 2;sodium/nucleoside cotransporter 2;sodium/purine nucleoside co-transporter;solute carrier family 28 (concentrative nucleoside transporter), member 2;solute carrier family 28 (sodium-coupled nucleoside transporter), member 2;Solute carrier family 28 member 2;SPNT;SPNT1
Extra Details:: Enables neurotransmitter transmembrane transporter activity and nucleoside transmembrane transporter activity. Involved in several processes, including nucleoside transport; purine nucleobase transmembrane transport; and pyrimidine-containing compound transmembrane transport. Predicted to be located in membrane. Predicted to be part of brush border membrane; coated vesicle; and vesicle membrane. Predicted to be integral component of plasma membrane.