CCDC6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16075
Additional Names:: CCDC6|D10S170|H4|PTC|PTC1|TPC|TST1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 56kDa/70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD
Uniprot:: Q16204
Synonyms:: coiled-coil domain-containing protein 6;D10S170;H4;papillary thyroid carcinoma-encoded protein;Protein H4;PTC;TPC;TST1
Extra Details:: This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.