A16074
ALDH5A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16074
- Additional Names:
- ALDH5A1|SSADH|SSDH
- Application:
- ELISA, WB
- Molecular Weight:
- 57kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV
- Uniprot:
- P51649
- Synonyms:
- Aldehyde dehydrogenase family 5 member A1;mitochondrial succinate semialdehyde dehydrogenase;NAD(+)-dependent succinic semialdehyde dehydrogenase;SSADH;SSDH;succinate-semialdehyde dehydrogenase, mitochondrial
- Extra Details:
- This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice