SLC18A3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16068
Additional Names:: CMS21|SLC18A3|VACHT
Application:: ELISA, IHC-P, IF
Molecular Weight:: 50 kDa(non-glycosylated), 70 kDa(glycosylated)
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
Uniprot:: Q16572
Synonyms:: CMS21;solute carrier family 18 (vesicular acetylcholine transporter), member 3;solute carrier family 18 (vesicular acetylcholine), member 3;Solute carrier family 18 member 3;solute carrier family 18, member 3;VACHT;vesicular acetylcholine transporter
Extra Details:: This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.