RAPGEF1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16050
Additional Names:: C3G|GRF2|RAPGEF1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 120kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT
Uniprot:: Q13905
Synonyms:: C3G;CRK SH3-binding GNRP;GRF2;Guanine nucleotide-releasing factor 2;guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene);Protein C3G;Rap guanine nucleotide exchange factor (GEF) 1;rap guanine nucleotide exchange factor 1
Extra Details:: This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.