A16046
FBLN1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16046
- Additional Names:
- FBLN|FBLN1|FIBL1
- Application:
- ELISA, WB
- Molecular Weight:
- 77kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RLPCHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLSRHGTVSS
- Uniprot:
- P23142
- Synonyms:
- FBLN;FIBL1;fibulin-1
- Extra Details:
- Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
_WB_02.jpg)