CD80 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16039
Additional Names:: B7|B7-1|B7.1|BB1|CD28LG|CD28LG1|CD80|LAB7
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 50-75 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS
Uniprot:: P33681
Synonyms:: activation B7-1 antigen;B-lymphocyte activation antigen B7;B7;B7-1;B7.1;BB1;CD28LG;CD28LG1;CD80 antigen (CD28 antigen ligand 1, B7-1 antigen);costimulatory factor CD80;costimulatory molecule variant IgV-CD80;CTLA-4 counter-receptor B7.1;LAB7;T-lymphocyte activation antigen CD80
Extra Details:: The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.