A16029
GLS2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16029
- Additional Names:
- GA|GLS|GLS2|hLGA|LGA
- Application:
- ELISA, WB
- Molecular Weight:
- 66kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV
- Uniprot:
- Q9UI32
- Synonyms:
- breast cell glutaminase;GA;GLS;glutaminase 2 (liver, mitochondrial);glutaminase I;glutaminase liver isoform, mitochondrial;hLGA;L-glutaminase;L-glutamine amidohydrolase;LGA;phosphate-activated glutaminase;phosphate-dependent glutaminase
- Extra Details:
- The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Originally thought to be liver-specific, this protein has been found in other tissues as well. Alternative splicing results in multiple transcript variants that encode different isoforms.
- Shipping Conditions:
- Blue Ice