A1602
CHRM3 Rabbit polyclonal antibody

Size
POA
- SKU:
- A1602
- Additional Names:
- CHRM3|EGBRS|HM3|PBS
- Application:
- ELISA, WB
- Molecular Weight:
- 66kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQI
- Uniprot:
- P20309
- Synonyms:
- acetylcholine receptor, muscarinic 3;EGBRS;HM3;m3 muscarinic receptor;muscarinic acetylcholine receptor M3;PBS
- Extra Details:
- The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities.
- Shipping Conditions:
- Blue Ice

