KDM2B Rabbit polyclonal antibody

Size

£152.00

SKU:: A16017
Additional Names:: CXXC2|Fbl10|FBXL10|JHDM1B|KDM2B|PCCX2
Application:: ELISA, WB
Molecular Weight:: 153kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN
Uniprot:: Q8NHM5
Synonyms:: [Histone-H3]-lysine-36 demethylase 1B;CXXC-type zinc finger protein 2;CXXC2;F-box and leucine-rich repeat protein 10;F-box protein FBL10;F-box/LRR-repeat protein 10;Fbl10;FBXL10;JEMMA (Jumonji domain, EMSY-interactor, methyltransferase motif) protein;JHDM1B;jmjC domain-containing histone demethylation protein 1B;jumonji C domain-containing histone demethylase 1B;Jumonji domain-containing EMSY-interactor methyltransferase motif protein;lysine (K)-specific demethylase 2B;lysine-specific demethylase 2B;PCCX2;protein-containing CXXC domain 2
Extra Details:: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.

Shipping Conditions:: Blue Ice