A16006
Zip12 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16006
- Additional Names:
- bA570F3.1|LZT-Hs8|ZIP-12|ZIP12
- Application:
- ELISA, WB
- Molecular Weight:
- 77kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
- Uniprot:
- Q504Y0
- Synonyms:
- bA570F3.1;LIV-1 subfamily of ZIP zinc transporter 8;LZT-Hs8;solute carrier family 39 (metal ion transporter), member 12;solute carrier family 39 (zinc transporter), member 12;Solute carrier family 39 member 12;zinc transporter ZIP12;ZIP-12;ZIP12;zrt- and Irt-like protein 12
- Extra Details:
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).
- Shipping Conditions:
- Blue Ice