A15999
GPX2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15999
- Additional Names:
- GI-GPx|GPRP|GPRP-2|GPx-2|GPx-GI|GPX2|GSHPx-2|GSHPX-GI
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 21kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
- Uniprot:
- P18283
- Synonyms:
- gastrointestinal glutathione peroxidase;GI-GPx;glutathione peroxidase 2;glutathione peroxidase 2 (gastrointestinal);Glutathione peroxidase-gastrointestinal;glutathione peroxidase-related protein 2;GPRP;GPRP-2;GPx-2;GPx-GI;GSHPx-2;GSHPX-GI;selenoprotein GPX2
- Extra Details:
- The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract (also in liver in human), is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Overexpression of this gene is associated with increased differentiation and proliferation in colorectal cancer. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
- Shipping Conditions:
- Blue Ice







