SULT1A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1599
Additional Names:: HAST1/HAST2|P-PST|P-PST 1|PST|ST1A1|ST1A3|STP|STP1|SULT1A1|ts-PST|TSPST1
Application:: ELISA, WB
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Uniprot:: P50225
Synonyms:: aryl sulfotransferase 1;HAST1/HAST2;P-PST;P-PST 1;Phenol sulfotransferase 1;phenol-sulfating phenol sulfotransferase 1;PST;ST1A1;ST1A3;STP;STP1;sulfotransferase 1A1;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1;Thermostable phenol sulfotransferase;thermostable phenol sulfotransferase1;ts-PST;TSPST1
Extra Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.

Shipping Conditions:: Blue Ice