UBAC2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15975
Additional Names:: PHGDHL1|UBAC2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 39kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQV
Uniprot:: Q8NBM4
Synonyms:: PHGDHL1;phosphoglycerate dehydrogenase like 1;phosphoglycerate dehydrogenase-like protein 1;RP11-178C10.1;UBA domain-containing protein 2;ubiquitin-associated domain-containing protein 2
Extra Details:: Involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Acts upstream of or within protein localization to endoplasmic reticulum. Located in endoplasmic reticulum.