SSC4D Rabbit polyclonal antibody

Size

£152.00

SKU:: A15957
Additional Names:: S4D-SRCRB|SRCRB-S4D|SRCRB4D|SSC4D
Application:: ELISA, WB
Molecular Weight:: 61kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Uniprot:: Q8WTU2
Synonyms:: four scavenger receptor cysteine-rich domains-containing protein;S4D-SRCRB;scavenger receptor cysteine rich domain containing, group B (4 domains);scavenger receptor cysteine rich family, 4 domains;scavenger receptor cysteine-rich domain-containing group B protein;scavenger receptor cysteine-rich protein SRCRB-S4D;SRCRB-S4D;SRCRB4D
Extra Details:: The scavenger receptor cysteine-rich (SRCR) superfamily is an ancient and highly conserved group of cell surface and/or secreted proteins, some of which are involved in the development of the immune system and the regulation of both innate and adaptive immune responses. Group B SRCR domains usually contain 8 regularly spaced cysteines that give rise to a well-defined intradomain disulfide-bond pattern.