A15957
SSC4D Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15957
- Additional Names:
- S4D-SRCRB|SRCRB-S4D|SRCRB4D|SSC4D
- Application:
- ELISA, WB
- Molecular Weight:
- 61kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
- Uniprot:
- Q8WTU2
- Synonyms:
- four scavenger receptor cysteine-rich domains-containing protein;S4D-SRCRB;scavenger receptor cysteine rich domain containing, group B (4 domains);scavenger receptor cysteine rich family, 4 domains;scavenger receptor cysteine-rich domain-containing group B protein;scavenger receptor cysteine-rich protein SRCRB-S4D;SRCRB-S4D;SRCRB4D
- Extra Details:
- The scavenger receptor cysteine-rich (SRCR) superfamily is an ancient and highly conserved group of cell surface and/or secreted proteins, some of which are involved in the development of the immune system and the regulation of both innate and adaptive immune responses. Group B SRCR domains usually contain 8 regularly spaced cysteines that give rise to a well-defined intradomain disulfide-bond pattern.
- Shipping Conditions:
- Blue Ice

