A15950
EDARADD Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15950
- Additional Names:
- CR|ECTD11A|ECTD11B|ED3|EDA3|EDARADD
- Application:
- ELISA, WB
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
- Uniprot:
- Q8WWZ3
- Synonyms:
- crinkled homolog;ECTD11A;ECTD11B;ectodysplasia A receptor associated death domain;ectodysplasin-A receptor-associated adapter protein;ED3;EDA3;EDAR-associated death domain protein;Protein crinkled homolog
- Extra Details:
- This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
- Shipping Conditions:
- Blue Ice

