A15949
TPRG1L Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15949
- Additional Names:
- FAM79A|h-mover|mover|SVAP30|TPRG1L|TPRGL
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI
- Uniprot:
- Q5T0D9
- Synonyms:
- FAM79A;family with sequence similarity 79, member A;h-mover;mossy fiber terminal-associated vertebrate-specific presynaptic protein;mover;Protein FAM79A;RP11-46F15.3;tumor protein p63-regulated gene 1-like protein
- Extra Details:
- Predicted to enable identical protein binding activity. Predicted to be involved in regulation of glutamatergic synaptic transmission. Located in extracellular exosome.
- Shipping Conditions:
- Blue Ice

