RBP7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15939
Additional Names:: CRABP4|CRBP4|CRBPIV|RBP7
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 15 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Uniprot:: Q96R05
Synonyms:: cellular retinoic acid-binding protein 4;cellular retinoic acid-binding protein IV;cellular retinol binding protein 7;CRABP4;CRBP4;CRBPIV;putative cellular retinol-binding protein CRBP IV;retinoid-binding protein 7;retinol binding protein 7, cellular
Extra Details:: The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs.