A15907
CD99L2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15907
- Additional Names:
- CD99B|CD99L2|MIC2L1
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPG
- Uniprot:
- Q8TCZ2
- Synonyms:
- CD99 antigen-like protein 2;CD99B;MIC2 like 1;MIC2-like protein 1;MIC2L1
- Extra Details:
- This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice