NDRG3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15876
Additional Names:: NDRG3
Application:: ELISA, WB
Molecular Weight:: 41kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC
Uniprot:: Q9UGV2
Synonyms:: N-myc downstream-regulated gene 3 protein;protein NDRG3
Extra Details:: Predicted to be involved in signal transduction. Located in cytoplasm.