A15873
ATP10A Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15873
- Additional Names:
- ATP10A|ATP10C|ATPVA|ATPVC
- Application:
- ELISA, WB
- Molecular Weight:
- 170kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
- Uniprot:
- O60312
- Synonyms:
- aminophospholipid translocase VA;ATP10C;ATPase class V type 10A;ATPase type IV, phospholipid transporting (P-type);ATPase, class V, type 10A;ATPase, Class V, type 10C;ATPVA;ATPVC;P4-ATPase flippase complex alpha subunit ATP10A;phospholipid-transporting ATPase VA;probable phospholipid-transporting ATPase VA
- Extra Details:
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. This gene is maternally expressed. It maps within the most common interval of deletion responsible for Angelman syndrome, also known as 'happy puppet syndrome'.
- Shipping Conditions:
- Blue Ice