A15863
ZFP64 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15863
- Additional Names:
- ZFP64|ZNF338
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MNASSEGESFAGSVQIPGGTTVLVELTPDIHICGICKQQFNNLDAFVAHKQSGCQLTGTSAAAPSTVQFVSEETVPATQTQTTTRTITSETQTITVSAPEFVFEHGYQTYLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYPGCQFKTAYGMKDMERHLKIHT
- Uniprot:
- Q9NPA5, Q9NTW7
- Synonyms:
- zinc finger protein 338;zinc finger protein 64;zinc finger protein 64 homolog;ZNF338
- Extra Details:
- Predicted to enable DNA binding activity and metal ion binding activity. Predicted to be involved in positive regulation of cytokine production and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of mRNA splicing, via spliceosome. Predicted to be active in nucleus.
- Shipping Conditions:
- Blue Ice

