BCMO1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15848
Additional Names:: BCDO|BCDO1|BCMO|BCMO1|BCO
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT
Uniprot:: Q9HAY6
Synonyms:: BCDO;BCDO1;BCMO;BCMO1;BCO;beta-carotene 15, 15'-dioxygenase 1;beta-carotene 15,15'-monooxygenase 1;beta-carotene dioxygenase 1;Beta-carotene oxygenase 1;beta,beta-carotene 15,15'-dioxygenase;beta,beta-carotene 15,15'-monooxygenase
Extra Details:: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.