A15848
BCMO1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15848
- Additional Names:
- BCDO|BCDO1|BCMO|BCMO1|BCO
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFAVPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRYVFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVSTDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT
- Uniprot:
- Q9HAY6
- Synonyms:
- BCDO;BCDO1;BCMO;BCMO1;BCO;beta-carotene 15, 15'-dioxygenase 1;beta-carotene 15,15'-monooxygenase 1;beta-carotene dioxygenase 1;Beta-carotene oxygenase 1;beta,beta-carotene 15,15'-dioxygenase;beta,beta-carotene 15,15'-monooxygenase
- Extra Details:
- Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.
- Shipping Conditions:
- Blue Ice

