SR-BI Rabbit polyclonal antibody

Size

£152.00

SKU:: A1584
Additional Names:: CD36L1|CLA-1|CLA1|HDLCQ6|HDLQTL6|SR-BI|SRB1
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
Uniprot:: Q8WTV0
Synonyms:: CD36 and LIMPII analogous 1;CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1;CD36 antigen-like 1;CD36L1;CLA-1;CLA1;Collagen type I receptor, thrombospondin receptor-like 1;HDLQTL6;scavenger receptor class B member 1;scavenger receptor class B type III;SR-BI;SRB1
Extra Details:: The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2 and facilitates cell entry by the virus, SARS-CoV2.