A1583
PXR Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1583
- Additional Names:
- BXR|ONR1|PAR|PAR1|PAR2|PARq|PRR|PXR|SAR|SXR
- Application:
- ELISA, WB
- Molecular Weight:
- 45 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKT
- Uniprot:
- O75469
- Synonyms:
- BXR;nuclear receptor subfamily 1 group I member 2;ONR1;orphan nuclear receptor PAR1;orphan nuclear receptor PXR;PAR;PAR1;PAR2;PARq;pregnane X nuclear receptor variant 2;pregnane X receptor;PRR;PXR;SAR;steroid and xenobiotic receptor;SXR
- Extra Details:
- This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized.
- Shipping Conditions:
- Blue Ice