MYEF2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15829
Additional Names:: HsT18564|MEF-2|MST156|MSTP156|myEF-2|MYEF2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADANKAEVPGATGGDSPHLQPAEPPGEPRREPHPAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLM
Uniprot:: Q9P2K5
Synonyms:: HsT18564;MEF-2;MST156;MSTP156;myEF-2;myelin expression factor 2;myelin gene expression factor 2
Extra Details:: Enables RNA binding activity. Involved in myotube differentiation and neuron differentiation. Located in nucleus.