PPA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15819
Additional Names:: HSPC124|PPA2|SCFAI|SCFI|SID6-306
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR
Uniprot:: Q9H2U2
Synonyms:: HSPC124;inorganic pyrophosphatase 2, mitochondrial;PPase 2;pyrophosphatase (inorganic) 2;pyrophosphatase SID6-306;pyrophosphate phospho-hydrolase 2;SCFAI;SCFI;SID6-306
Extra Details:: The protein encoded by this gene is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.