CHP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15791
Additional Names:: CHP|CHP1|p22|p24|Sid470p|SLC9A1BP|SPAX9
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
Uniprot:: Q99653
Synonyms:: calcineurin B homolog;calcineurin B homologous protein 1;calcineurin B-like protein;calcineurin homologous protein;calcium binding protein P22;calcium-binding protein CHP;calcium-binding protein p22;CHP;EF-hand calcium-binding domain-containing protein p22;p22;p24;Sid470p;SLC9A1 binding protein;SLC9A1BP;SPAX9
Extra Details:: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.