A15791
CHP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15791
- Additional Names:
- CHP|CHP1|p22|p24|Sid470p|SLC9A1BP|SPAX9
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
- Uniprot:
- Q99653
- Synonyms:
- calcineurin B homolog;calcineurin B homologous protein 1;calcineurin B-like protein;calcineurin homologous protein;calcium binding protein P22;calcium-binding protein CHP;calcium-binding protein p22;CHP;EF-hand calcium-binding domain-containing protein p22;p22;p24;Sid470p;SLC9A1 binding protein;SLC9A1BP;SPAX9
- Extra Details:
- This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
- Shipping Conditions:
- Blue Ice





