ME3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15787
Additional Names:: ME3|NADP-ME
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Uniprot:: Q16798
Synonyms:: malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+));Malic enzyme 3;malic enzyme 3, NADP(+)-dependent, mitochondrial;malic enzyme, NADP+-dependent, mitochondrial;mitochondrial NADP(+)-dependent malic enzyme 3;NADP-dependent malic enzyme, mitochondrial;NADP-ME;pyruvic-malic carboxylase
Extra Details:: Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.