POLR3C Rabbit polyclonal antibody

Size

£152.00

SKU:: A15784
Additional Names:: C82|POLR3C|RPC3|RPC62
Application:: ELISA, WB
Molecular Weight:: 63kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQHNLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSAVVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTLVINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTM
Uniprot:: Q9BUI4
Synonyms:: C82;DNA-directed III 62 kDa polypeptide;DNA-directed RNA polymerase III subunit C;DNA-directed RNA polymerase III subunit RPC3;polymerase (RNA) III (DNA directed) polypeptide C (62kD);polymerase (RNA) III subunit C;RNA polymerase III 62 kDa subunit;RNA polymerase III subunit C3;RPC3;RPC62
Extra Details:: Enables single-stranded DNA binding activity. Involved in positive regulation of innate immune response and positive regulation of interferon-beta production. Located in nucleoplasm. Part of RNA polymerase III complex.