ACAA2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A15778
Additional Names:: ACAA2|DSAEC
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNA
Uniprot:: P42765
Synonyms:: 3-ketoacyl-CoA thiolase, mitochondrial;acetyl-CoA acetyltransferase;Acetyl-CoA acyltransferase;acetyl-Coenzyme A acyltransferase 2;acyl-CoA hydrolase, mitochondrial;beta ketothiolase;Beta-ketothiolase;DSAEC;mitochondrial 3-oxoacyl-CoA thiolase;mitochondrial 3-oxoacyl-Coenzyme A thiolase;T1
Extra Details:: The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.