A15756
FHL5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A15756
- Additional Names:
- 1700027G07Rik|ACT|dJ393D12.2|FHL-5|FHL5
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
- Uniprot:
- Q5TD97
- Synonyms:
- 1700027G07Rik;ACT;activator of cAMP-responsive element modulator (CREM) in testis;activator of cAMP-responsive element modulator in testis;dJ393D12.2;FHL-5;four and a half LIM domains protein 5;LIM protein ACT
- Extra Details:
- The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)