A15743
PPAP2B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A15743
- Additional Names:
- Dri42|LPP3|PAP2B|PPAP2B|VCIP
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
- Uniprot:
- O14495
- Synonyms:
- Dri42;lipid phosphate phosphohydrolase 3;LPP3;PAP2 beta;PAP2-beta;PAP2B;phosphatidate phosphohydrolase type 2b;Phosphatidic acid phosphatase 2b;phosphatidic acid phosphatase type 2B;phospholipid phosphatase 3;PPAP2B;type-2 phosphatidic acid phosphatase-beta;vascular endothelial growth factor and type I collagen inducible;Vascular endothelial growth factor and type I collagen-inducible protein;VCIP
- Extra Details:
- The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.
- Shipping Conditions:
- Blue Ice