KDM5C Rabbit polyclonal antibody

Size

£152.00

SKU:: A15740
Additional Names:: DXS1272E|JARID1C|KDM5C|MRX13|MRXJ|MRXSCJ|MRXSJ|SMCX|XE169
Application:: ELISA, WB
Molecular Weight:: 180 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
Uniprot:: P41229
Synonyms:: [histone H3]-trimethyl-L-lysine(4) demethylase 5C;DXS1272E;histone demethylase JARID1C;JARID1C;JmjC domain-containing protein SMCX;Jumonji, AT rich interactive domain 1C (RBP2-like);Jumonji/ARID domain-containing protein 1C;lysine (K)-specific demethylase 5C;lysine-specific demethylase 5C;MRX13;MRXJ;MRXSCJ;MRXSJ;Protein SmcX;Protein Xe169;SMCX;Smcx homolog, X chromosome;Smcy homolog, X-linked;XE169
Extra Details:: This gene is a member of the SMCY homolog family and encodes a protein with one ARID domain, one JmjC domain, one JmjN domain and two PHD-type zinc fingers. The DNA-binding motifs suggest this protein is involved in the regulation of transcription and chromatin remodeling. Mutations in this gene have been associated with X-linked cognitive disability. Alternative splicing results in multiple transcript variants.